PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG346800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 173aa    MW: 19824.2 Da    PI: 10.7411
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG346800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181057148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT +Ed llv+ v+q+G g+W+++++  g++R++k+c++rw +yl
  Pavir.7NG346800.1.p 10 KGPWTSQEDTLLVEHVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 57
                         79********************************************97 PP

2Myb_DNA-binding55.41.4e-1763107147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  Pavir.7NG346800.1.p  63 RGKITPQEESIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 107
                          8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.209557IPR017930Myb domain
SuperFamilySSF466896.88E-308104IPR009057Homeodomain-like
SMARTSM007172.3E-15959IPR001005SANT/Myb domain
PfamPF002494.0E-171057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-231164IPR009057Homeodomain-like
CDDcd001672.56E-111257No hitNo description
PROSITE profilePS5129425.39658112IPR017930Myb domain
SMARTSM007176.6E-1662110IPR001005SANT/Myb domain
PfamPF002494.5E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2465110IPR009057Homeodomain-like
CDDcd001678.99E-1167108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
GRQEVDGWRK GPWTSQEDTL LVEHVRQHGE GRWNSVSKLT GLKRSGKSCR LRWVNYLRPD  60
LKRGKITPQE ESIIVQLHAL WGNRWSTIAR SLPGRTDNEI KNYWRTHFKK GKPAKNIERA  120
RARFLKQRQE MQSQQQQLLQ LAAGQVAKDE NQDGGGARTG ADDDDRGSAV VDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271011027126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-129AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-101PREDICTED: transcription repressor MYB6-like
SwissprotQ4JL843e-51MYB59_ARATH; Transcription factor MYB59
TrEMBLK3Y9D01e-101K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-100(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.15e-65myb domain protein 79